SEC24A monoclonal antibody (M01), clone 4D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SEC24A.
Immunogen
SEC24A (XP_094581.5, 301 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PLTSSYRDVPQPLFNSAVNQEGITSNTNNGSMVVHSSYDEIEGGGLLATPQLTNKNPKMSRSVGYSYPSLPPGYQNTTPPGATGVPPSSL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (70); Rat (78)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SEC24A is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — SEC24A
Entrez GeneID
10802GeneBank Accession#
XM_094581Protein Accession#
XP_094581.5Gene Name
SEC24A
Gene Alias
-
Gene Description
SEC24 family, member A (S. cerevisiae)
Omim ID
607183Gene Ontology
HyperlinkGene Summary
In yeast, the Sec23-Sec24 complex is a component of coat protein II (COPII; see MIM 601924)-coated vesicles that mediate protein transport from the endoplasmic reticulum. SEC24A is 1 of several mammalian proteins that show structural and functional homology to yeast Sec24.[supplied by OMIM
Other Designations
SEC24 related gene family, member A
-
Interactome
-
Publication Reference
-
The role of the C-terminal domain of PCSK9 and SEC24 isoforms in PCSK9 secretion.
Deng SJ, Shen Y, Gu HM, Guo S, Wu SR, Zhang DW.
Biochimica et Biophysica Acta. Molecular and Cell Biology of Lipids 2020 Jun; 1865(6):158660.
Application:WB-Tr, Human, Huh7 cells.
-
The role of the C-terminal domain of PCSK9 and SEC24 isoforms in PCSK9 secretion.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com