LEFTY1 monoclonal antibody (M03), clone 2E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant LEFTY1.
Immunogen
LEFTY1 (AAH27883, 1 a.a. ~ 366 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MQPLWLCWALWVLPLASPGAALAGEQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQYVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSLRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81); Rat (80)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
LEFTY1 monoclonal antibody (M03), clone 2E10. Western Blot analysis of LEFTY1 expression in C32 ( Cat # L002V1 ).Western Blot (Cell lysate)
LEFTY1 monoclonal antibody (M03), clone 2E10 Western Blot analysis of LEFTY1 expression in THP-1 ( Cat # L007V1 ).ELISA
-
Gene Info — LEFTY1
Entrez GeneID
10637GeneBank Accession#
BC027883Protein Accession#
AAH27883Gene Name
LEFTY1
Gene Alias
LEFTB, LEFTYB
Gene Description
left-right determination factor 1
Omim ID
603037Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the TGF-beta family of proteins. A similar secreted protein in mouse plays a role in left-right asymmetry determination of organ systems during development. Alternative processing of this protein can yield three different products. This gene is closely linked to both a related family member and a related pseudogene. [provided by RefSeq
Other Designations
OTTHUMP00000035572|left-right determination, factor B
-
Pathway
-
Disease
-
Publication Reference
-
Identification of the role of bone morphogenetic protein (BMP) and TGF-β signaling in the trajectory of serotonergic differentiation in a rapid assay in mouse embryonic stem cells in vitro.
Yamasaki A, Kasai A, Toi A, Kurita M, Kimoto S, Hayata-Takano A, Nakazawa T, Nagayasu K, Shintani N, Hashimoto R, Ito A, Meltzer HY, Ago Y, Waschek JA, Onaka Y, Matsuda T, Baba A, Hashimoto H.
Journal of Neurochemistry 2015 Feb; 132(4):418.
Application:IF, Mouse, ES cells.
-
Identification of the role of bone morphogenetic protein (BMP) and TGF-β signaling in the trajectory of serotonergic differentiation in a rapid assay in mouse embryonic stem cells in vitro.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com