CCT7 monoclonal antibody (M01), clone 1D6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CCT7.
Immunogen
CCT7 (AAH19296, 425 a.a. ~ 528 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVD
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (95); Rat (96)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.07 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CCT7 monoclonal antibody (M01), clone 1D6. Western Blot analysis of CCT7 expression in human pancreas.Western Blot (Cell lysate)
CCT7 monoclonal antibody (M01), clone 1D6 Western Blot analysis of CCT7 expression in HL-60 ( Cat # L014V1 ).Western Blot (Cell lysate)
CCT7 monoclonal antibody (M01), clone 1D6. Western Blot analysis of CCT7 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
CCT7 monoclonal antibody (M01), clone 1D6. Western Blot analysis of CCT7 expression in K-562 ( Cat # L009V1 ).Western Blot (Cell lysate)
CCT7 monoclonal antibody (M01), clone 1D6. Western Blot analysis of CCT7 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
CCT7 monoclonal antibody (M01), clone 1D6. Western Blot analysis of CCT7 expression in 293.Western Blot (Cell lysate)
CCT7 monoclonal antibody (M01), clone 1D6. Western Blot analysis of CCT7 expression in PC-12(Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CCT7 expression in transfected 293T cell line by CCT7 monoclonal antibody (M01), clone 1D6.
Lane 1: CCT7 transfected lysate(59.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CCT7 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — CCT7
Entrez GeneID
10574GeneBank Accession#
BC019296Protein Accession#
AAH19296Gene Name
CCT7
Gene Alias
CCT-ETA, Ccth, MGC110985, Nip7-1, TCP-1-eta
Gene Description
chaperonin containing TCP1, subunit 7 (eta)
Omim ID
605140Gene Ontology
HyperlinkGene Summary
This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants encoding different isoforms have been found for this gene, but only two of them have been characterized to date. [provided by RefSeq
Other Designations
HIV-1 Nef interacting protein|T-complex protein 1, eta subunit|chaperonin containing TCP1, subunit 7|chaperonin containing t-complex polypeptide 1, eta subunit
-
Interactome
-
Publication Reference
-
Interaction with the CCT chaperonin complex limits APOBEC3A cytidine deaminase cytotoxicity.
Abby M Green, Rachel A DeWeerd, David R O'Leary, Ava R Hansen, Katharina E Hayer, Katarzyna Kulej, Ariel S Dineen, Julia H Szeto, Benjamin A Garcia, Matthew D Weitzman.
EMBO reports 2021 Sep; 22(9):e52145.
Application:IP, WB-Tr, Human, CEM, HEK 293T, HepaRG, K-562, MDA-MB-231, Ramos, U-2 OS cells.
-
TRiC controls transcription resumption after UV damage by regulating Cockayne syndrome protein A.
Pines A, Dijk M, Makowski M, Meulenbroek EM, Vrouwe MG, van der Weegen Y, Baltissen M, French PJ, van Royen ME, Luijsterburg MS, Mullenders LH, Vermeulen M, Vermeulen W, Pannu NS, van Attikum H.
Nature Communications 2018 Mar; 9(1):1040.
Application:WB, Human, VH10-hTert cells.
-
Proteostatic Control of Telomerase Function through TRiC-Mediated Folding of TCAB1.
Freund A, Zhong FL, Venteicher AS, Meng Z, Veenstra TD, Frydman J, Artandi SE.
Cell 2014 Dec; 159(6):1389.
Application:WB-Tr, Human, HeLa S3 cells transfected with siRNAs against eight TRiC subunits.
-
Interaction with the CCT chaperonin complex limits APOBEC3A cytidine deaminase cytotoxicity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com