HBXIP (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HBXIP full-length ORF ( AAH62619, 83 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAAHKMAS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.75
Interspecies Antigen Sequence
Mouse (80); Rat (76)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HBXIP
Entrez GeneID
10542GeneBank Accession#
BC062619Protein Accession#
AAH62619Gene Name
HBXIP
Gene Alias
MGC71071, XIP
Gene Description
hepatitis B virus x interacting protein
Omim ID
608521Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus. [provided by RefSeq
Other Designations
HBx-interacting protein|hepatitis B virus x-interacting protein|hepatitis B virus x-interacting protein (9.6kD)
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com