DCTN2 monoclonal antibody (M01), clone 2G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
DCTN2 monoclonal antibody (M01), clone 2G7 Western Blot analysis of DCTN2 expression in MCF-7 ( Cat # L046V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DCTN2 is approximately 0.3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to DCTN2 on MCF-7 cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DCTN2.
Immunogen
DCTN2 (AAH00718, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKLGK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (95)
Isotype
IgG1 lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DCTN2 monoclonal antibody (M01), clone 2G7 Western Blot analysis of DCTN2 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DCTN2 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to DCTN2 on MCF-7 cell . [antibody concentration 10 ug/ml] -
Gene Info — DCTN2
Entrez GeneID
10540GeneBank Accession#
BC000718Protein Accession#
AAH00718Gene Name
DCTN2
Gene Alias
DCTN50, DYNAMITIN, RBP50
Gene Description
dynactin 2 (p50)
Omim ID
607376Gene Ontology
HyperlinkGene Summary
This gene encodes a 50-kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 4-5 copies per dynactin molecule. It contains three short alpha-helical coiled-coil domains that may mediate association with self or other dynactin subunits. It may interact directly with the largest subunit (p150) of dynactin and may affix p150 in place. [provided by RefSeq
Other Designations
50 kD dynein-associated polypeptide|dynactin 2|dynactin complex 50 kD subunit
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com