PPIE monoclonal antibody (M02), clone 2F5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PPIE.
Immunogen
PPIE (NP_006103, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDD
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PPIE monoclonal antibody (M02), clone 2F5. Western Blot analysis of PPIE expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
PPIE monoclonal antibody (M02), clone 2F5. Western Blot analysis of PPIE expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
PPIE monoclonal antibody (M02), clone 2F5 Western Blot analysis of PPIE expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
PPIE monoclonal antibody (M02), clone 2F5. Western Blot analysis of PPIE expression in PC-12(Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PPIE expression in transfected 293T cell line by PPIE monoclonal antibody (M02), clone 2F5.
Lane 1: PPIE transfected lysate(33.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PPIE is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PPIE on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PPIE
Entrez GeneID
10450GeneBank Accession#
NM_006112Protein Accession#
NP_006103Gene Name
PPIE
Gene Alias
CYP-33, MGC111222, MGC3736
Gene Description
peptidylprolyl isomerase E (cyclophilin E)
Omim ID
602435Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities and also exhibit RNA-binding activity. Three alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
Other Designations
OTTHUMP00000010837|OTTHUMP00000010838|PPIase E|cyclophilin 33|cyclophilin E|peptidyl-prolyl cis-trans isomerase E|peptidylprolyl isomerase E|peptidylprolyl isomerase E, isoform 1|rotamase E
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com