ACTR1B MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
ACTR1B MaxPab polyclonal antibody. Western Blot analysis of ACTR1B expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of ACTR1B expression in transfected 293T cell line (H00010120-T01) by ACTR1B MaxPab polyclonal antibody.
Lane 1: ACTR1B transfected lysate(41.36 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ACTR1B protein.
Immunogen
ACTR1B (NP_005726.1, 1 a.a. ~ 376 a.a) full-length human protein.
Sequence
MESYDIIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEALETEKVQYTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVLSGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ACTR1B MaxPab polyclonal antibody. Western Blot analysis of ACTR1B expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of ACTR1B expression in transfected 293T cell line (H00010120-T01) by ACTR1B MaxPab polyclonal antibody.
Lane 1: ACTR1B transfected lysate(41.36 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ACTR1B
Entrez GeneID
10120GeneBank Accession#
NM_005735.2Protein Accession#
NP_005726.1Gene Name
ACTR1B
Gene Alias
ARP1B, CTRN2, PC3
Gene Description
ARP1 actin-related protein 1 homolog B, centractin beta (yeast)
Omim ID
605144Gene Ontology
HyperlinkGene Summary
This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex. [provided by RefSeq
Other Designations
ARP1 actin-related protein 1 homolog B, centractin beta|centractin beta
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com