ACTR3 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ACTR3 full-length ORF ( AAH44590, 1 a.a. - 418 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIAEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
71.72
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ACTR3
Entrez GeneID
10096GeneBank Accession#
BC044590Protein Accession#
AAH44590Gene Name
ACTR3
Gene Alias
ARP3
Gene Description
ARP3 actin-related protein 3 homolog (yeast)
Omim ID
604222Gene Ontology
HyperlinkGene Summary
The specific function of this gene has not yet been determined; however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. [provided by RefSeq
Other Designations
ARP3 actin-related protein 3 homolog
-
Interactome
-
Publication Reference
-
Plasma IgG autoantibody against actin-related protein 3 in liver fluke Opisthorchis viverrini infection.
Rucksaken R, Haonon O, Pinlaor P, Pairojkul C, Roytrakul S, Yongvanit P, Selmi C, Pinlaor S.
Parasite Immunology 2015 Jul; 37(7):340.
Application:ELISA, WB, Human, Plasma.
-
Plasma IgG autoantibody against actin-related protein 3 in liver fluke Opisthorchis viverrini infection.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com