EDIL3 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human EDIL3 full-length ORF ( NP_005702.3, 1 a.a. - 480 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MKRSVAVWLLVGLSLGVPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
80.2
Interspecies Antigen Sequence
Mouse (95); Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — EDIL3
Entrez GeneID
10085GeneBank Accession#
NM_005711.3Protein Accession#
NP_005702.3Gene Name
EDIL3
Gene Alias
DEL1, MGC26287
Gene Description
EGF-like repeats and discoidin I-like domains 3
Omim ID
606018Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior. [provided by RefSeq
Other Designations
EGF-like repeats and discoidin I-like domains-containing protein 3|developmental endothelial locus-1
-
Interactome
-
Disease
-
Publication Reference
-
Diapedesis-Induced Integrin Signaling via LFA-1 Facilitates Tissue Immunity by Inducing Intrinsic Complement C3 Expression in Immune Cells.
Martin Kolev, Erin E West, Natalia Kunz, Daniel Chauss, E Ashley Moseman, Jubayer Rahman, Tilo Freiwald, Maria L Balmer, Jonas Lötscher, Sarah Dimeloe, Elizabeth C Rosser, Lucy R Wedderburn, Katrin D Mayer-Barber, Andrea Bohrer, Paul Lavender, Andrew Cope, Luopin Wang, Mariana J Kaplan, Niki M Moutsopoulo, Dorian McGavern, Steven M Holland, Christoph Hess, Majid Kazemian, Behdad Afzali, Claudia Kemper.
Immunity 2020 Mar; 52(3):513.
Application:Sub, Human, Human CD4+ T cells.
-
Diapedesis-Induced Integrin Signaling via LFA-1 Facilitates Tissue Immunity by Inducing Intrinsic Complement C3 Expression in Immune Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com