PDCD7 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PDCD7 partial ORF ( AAH16992, 47 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
KRELEKKQRKEKEKILLQKREIESKLFGDPDEFPLAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWATAVKLH
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Interspecies Antigen Sequence
Mouse (94); Rat (95)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PDCD7
Entrez GeneID
10081GeneBank Accession#
BC016992Protein Accession#
AAH16992Gene Name
PDCD7
Gene Alias
ES18, HES18, MGC22015
Gene Description
programmed cell death 7
Omim ID
608138Gene Ontology
HyperlinkGene Summary
This gene encodes a protein with sequence similarity to a mouse protein originally identified in embryonic stem cells. In mouse T-cell lines, this protein appears to be related to glucocorticoid- and staurine-induced apoptotic pathways, and to be linked to ceramide-mediated signalling. These observations suggest that this gene product is involved in specific apoptotic processes in T-cells. [provided by RefSeq
Other Designations
U11/U12 snRNP 59K|apoptosis-related protein ES18
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com