KCNE3 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human KCNE3 full-length ORF (BAG34817.1, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMYILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.73
Interspecies Antigen Sequence
Mouse (93); Rat (88)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — KCNE3
Entrez GeneID
10008GeneBank Accession#
AK311876.1Protein Accession#
BAG34817.1Gene Name
KCNE3
Gene Alias
DKFZp781H21101, HOKPP, MGC102685, MGC129924, MiRP2
Gene Description
potassium voltage-gated channel, Isk-related family, member 3
Gene Ontology
HyperlinkGene Summary
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a type I membrane protein, and a beta subunit that assembles with a potassium channel alpha-subunit to modulate the gating kinetics and enhance stability of the multimeric complex. This gene is prominently expressed in the kidney. A missense mutation in this gene is associated with hypokalemic periodic paralysis. [provided by RefSeq
Other Designations
cardiac voltage-gated potassium channel accessory subunit|minK-related peptide 2|minimum potassium ion channel-related peptide 2|potassium voltage-gated channel subfamily E member 3|voltage-gated K+ channel subunit MIRP2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com