ROD1 monoclonal antibody (M01), clone 4C9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ROD1.
Immunogen
ROD1 (NP_005147, 16 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GSDELLSSGIINGPFTMNSSTPSTANGNDSKKFKRDRPPCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYY
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (92); Rat (88)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ROD1 monoclonal antibody (M01), clone 4C9. Western Blot analysis of ROD1 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
ROD1 monoclonal antibody (M01), clone 4C9. Western Blot analysis of ROD1 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
ROD1 monoclonal antibody (M01), clone 4C9 Western Blot analysis of ROD1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ROD1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ROD1 on HeLa cell. [antibody concentration 20 ug/ml] -
Gene Info — ROD1
Entrez GeneID
9991GeneBank Accession#
NM_005156Protein Accession#
NP_005147Gene Name
ROD1
Gene Alias
DKFZp781I1117, PTBP3
Gene Description
ROD1 regulator of differentiation 1 (S. pombe)
Omim ID
607527Gene Ontology
HyperlinkGene Summary
ROD1 is a functional homolog of nrd1, an S. pombe RNA-binding protein that suppresses the onset of differentiation.[supplied by OMIM
Other Designations
OTTHUMP00000021933|ROD1 regulator of differentiation 1|fission yeast differentiation regulator|regulator of differentiation (in S. pombe) 1|regulator of differentiation (in S. pombi) 1
-
Interactome
-
Disease
-
Publication Reference
-
The RNA-binding protein ROD1/PTBP3 cotranscriptionally defines AID-loading sites to mediate antibody class switch in mammalian genomes.
Chen J, Cai Z, Bai M, Yu X, Zhang C, Cao C, Hu X, Wang L, Su R, Wang D, Wang L, Yao Y, Ye R, Hou B, Yu Y, Yu S, Li J, Xue Y.
Cell Research 2018 Oct; 28(10):981.
Application:IF, IP-WB, WB-Ce, Mouse, B cells, Splenic.
-
The RNA-binding protein ROD1/PTBP3 cotranscriptionally defines AID-loading sites to mediate antibody class switch in mammalian genomes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com