MED12 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (38.54 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant MED12.
Immunogen
MED12 (NP_005111, 1829 a.a. ~ 1941 a.a) partial recombinant protein with GST tag.
Sequence
QPATKTEDYGMGPGRSGPYGVTVPPDLLHHPNPGSITHLNYRQGSIGLYTQNQPLPAGGPRVDPYRPVRLPMQKLPTRPTYPGVLPTTMTGVMGLEPSSYKTSVYRQQQPAVP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.54 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — MED12
Entrez GeneID
9968GeneBank Accession#
NM_005120Protein Accession#
NP_005111Gene Name
MED12
Gene Alias
CAGH45, FGS1, HOPA, KIAA0192, OKS, OPA1, TNRC11, TRAP230
Gene Description
mediator complex subunit 12
Omim ID
300188Gene Ontology
HyperlinkGene Summary
The initiation of transcription is controlled in part by a large protein assembly known as the preinitiation complex. A component of this preinitiation complex is a 1.2 MDa protein aggregate called Mediator. This Mediator component binds with a CDK8 subcomplex which contains the protein encoded by this gene, mediator complex subunit 12 (MED12), along with MED13, CDK8 kinase, and cyclin C. The CDK8 subcomplex modulates Mediator-polymerase II interactions and thereby regulates transcription initiation and reinitation rates. The MED12 protein is essential for activating CDK8 kinase. Defects in this gene cause X-linked Opitz-Kaveggia syndrome, also known as FG syndrome, and Lujan-Fryns syndrome. [provided by RefSeq
Other Designations
FG syndrome 1|OPA-containing protein|OTTHUMP00000023491|mediator of RNA polymerase II transcription, subunit 12 homolog|thyroid hormone receptor-associated protein, 230 kDa subunit|trinucleotide repeat containing 11 (THR-associated protein, 230 kDa subuni
-
Interactome
-
Disease
-
Publication Reference
-
TP-064, a potent and selective small molecule inhibitor of PRMT4 for multiple myeloma.
Nakayama K, Szewczyk MM, Dela Sena C, Wu H, Dong A, Zeng H, Li F, de Freitas RF, Eram MS, Schapira M, Baba Y, Kunitomo M, Cary DR, Tawada M, Ohashi A, Imaeda Y, Saikatendu KS, Grimshaw CE, Vedadi M, Arrowsmith CH, Barsyte-Lovejoy D, Kiba A, Tomita D, Brown PJ.
Oncotarget 2018 Apr; 9(26):18480.
Application：WB, Human, HEK 293 cells.
-
Discovery of a Potent, Selective and Cell-active Dual Inhibitor of Protein Arginine Methyltransferase 4 and Protein Arginine Methyltransferase 6.
Shen Y, Szewczyk MM, Eram MS, Smil D, Kaniskan HÜ, de Freitas RF, Senisterra G, Li F, Schapira M, Brown PJ, Arrowsmith CH, Barsyte-Lovejoy D, Liu J, Vedadi M, Jin J.
Journal of Medicinal Chemistry 2016 Sep; 59(19):9124.
Application：WB, Human, HEK293 cells.
-
Distinct alternative splicing patterns of mediator subunit genes during endothelial progenitor cell differentiation.
Rienzo M, Casamassimi A, Schiano C, Grimaldi V, Infante T, Napoli C.
Biochimie 2012 Aug; 94(8):1828.
Application：WB-Ce, Human, EPCs.
-
TP-064, a potent and selective small molecule inhibitor of PRMT4 for multiple myeloma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com