OXSR1 monoclonal antibody (M09), clone 5D5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant OXSR1.
Immunogen
OXSR1 (AAH08726.1, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
OXSR1 monoclonal antibody (M09), clone 5D5 Western Blot analysis of OXSR1 expression in HeLa ( Cat # L013V1 ).ELISA
-
Gene Info — OXSR1
Entrez GeneID
9943GeneBank Accession#
BC008726.1Protein Accession#
AAH08726.1Gene Name
OXSR1
Gene Alias
KIAA1101, OSR1
Gene Description
oxidative-stress responsive 1
Omim ID
604046Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the Ser/Thr protein kinase family of proteins. It regulates downstream kinases in response to environmental stress, and may play a role in regulating the actin cytoskeleton. [provided by RefSeq
Other Designations
-
-
Interactome
-
Publication Reference
-
Common noncoding UMOD gene variants induce salt-sensitive hypertension and kidney damage by increasing uromodulin expression.
Trudu M, Janas S, Lanzani C, Debaix H, Schaeffer C, Ikehata M, Citterio L, Demaretz S, Trevisani F, Ristagno G, Glaudemans B, Laghmani K.
Nature Medicine 2013 Dec; 19(12):1655.
Application:WB, Mouse, Kidney.
-
Impaired KLHL3-Mediated Ubiquitination of WNK4 Causes Human Hypertension.
Wakabayashi M, Mori T, Isobe K, Sohara E, Susa K, Araki Y, Chiga M, Kikuchi E, Nomura N, Mori Y, Matsuo H, Murata T, Nomura S, Asano T, Kawaguchi H, Nonoyama S, Rai T, Sasaki S, Uchida S.
Cell Reports 2013 Mar; 3(3):858.
Application:WB, Mouse, Mouse kidney.
-
WNK-OSR1/SPAK-NCC signal cascade has circadian rhythm dependent on aldosterone.
Susa K, Sohara E, Isobe K, Chiga M, Rai T, Sasaki S, Uchida S.
Biochemical and Biophysical Research Communications 2012 Nov; 427(4):743.
Application:WB, Mouse, Kidney.
-
Effect of heterozygous deletion of WNK1 on the WNK-OSR1/ SPAK-NCC/NKCC1/NKCC2 signal cascade in the kidney and blood vessels.
Susa K, Kita S, Iwamoto T, Yang SS, Lin SH, Ohta A, Sohara E, Rai T, Sasaki S, Alessi DR, Uchida S.
Clinical and Experimental Nephrology 2012 Aug; 16(4):530.
Application:WB-Ti, Mouse, Mouse kidneys.
-
Phenotypes of pseudohypoaldosteronism type II caused by the WNK4 D561A missense mutation are dependent on the WNK-OSR1/SPAK kinase cascade.
Chiga M, Rafiqi FH, Alessi DR, Sohara E, Ohta A, Rai T, Sasaki S, Uchida S.
Journal of Cell Science 2011 May; 124(Pt 9):1391.
Application:WB, Mouse, Kidney.
-
Common noncoding UMOD gene variants induce salt-sensitive hypertension and kidney damage by increasing uromodulin expression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com