FEZ1 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FEZ1 protein.
Immunogen
FEZ1 (NP_005094.1, 1 a.a. ~ 392 a.a) full-length human protein.
Sequence
MEAPLVSLDEEFEDLRPSCSEDPEEKPQCFYGSSPHHLEDPSLSELENFSSEIISFKSMEDLVNEFDEKLNVCFRNYNAKTENLAPVKNQLQIQEEEETLQDEEVWDALTDNYIPSLSEDWRDPNIEALNGNCSDTEIHEKEEEEFNEKSENDSGINEEPLLTADQVIEEIEEMMQNSPDPEEEEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTELLDQVEGAIRDFSEELVQQLARRDELEFEKEVKNSFITVLIEVQNKQKEQRELMKKRRKEKGLSLQSSRIEKGNQMPLKRFSMEGISNILQSGIRQTFGSSGTDKQYLNTVIPYEKKASPPSVEDLQMLTNILFAMKEDNEKVPTLLTDYILKVLCPT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FEZ1 expression in transfected 293T cell line (H00009638-T02) by FEZ1 MaxPab polyclonal antibody.
Lane 1: FEZ1 transfected lysate(43.12 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — FEZ1
Entrez GeneID
9638GeneBank Accession#
NM_005103.3Protein Accession#
NP_005094.1Gene Name
FEZ1
Gene Alias
-
Gene Description
fasciculation and elongation protein zeta 1 (zygin I)
Omim ID
604825Gene Ontology
HyperlinkGene Summary
This gene is an ortholog of the C. elegans unc-76 gene, which is necessary for normal axonal bundling and elongation within axon bundles. Expression of this gene in C. elegans unc-76 mutants can restore to the mutants partial locomotion and axonal fasciculation, suggesting that it also functions in axonal outgrowth. The N-terminal half of the gene product is highly acidic. Alternatively spliced transcript variants encoding different isoforms of this protein have been described. [provided by RefSeq
Other Designations
zygin 1
-
Interactome
-
Disease
-
Publication Reference
-
FEZ1 phosphorylation regulates HSPA8 localization and interferon-stimulated gene expression.
Viacheslav Malikov, Nathan Meade, Lacy M. Simons, Judd F. Hultquist, Mojgan H. Naghavi.
Cell Reports 2022 Feb; 38(7):110396.
Application:Co-IP, Human, CHME3 cells.
-
Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC.
McKnight NC, Jefferies HB, Alemu EA, Saunders RE, Howell M, Johansen T, Tooze SA.
The EMBO Journal 2012 Apr; 31(8):1931.
Application:WB-Tr, Human, HEK 293 cells.
-
FEZ1 phosphorylation regulates HSPA8 localization and interferon-stimulated gene expression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com