MTRF1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MTRF1 protein.
Immunogen
MTRF1 (ENSP00000239852, 1 a.a. ~ 151 a.a) full-length human protein.
Sequence
MNRHLCVWLFRHPSLNGYLQCHIQLHSHQFRQIHLDTRLQVFRQNRNCILHLLSKNWSRRYCHQDTKMLWKHKALQKYMENLSKEYQTLEQCLQHIPVNEENRRSLNRRHAELAPLAAIYQEIQETEQAIEELESMCKKTESCSVAQAGMQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (66); Rat (65)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MTRF1 MaxPab polyclonal antibody. Western Blot analysis of MTRF1 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of MTRF1 expression in transfected 293T cell line by MTRF1 MaxPab polyclonal antibody.
Lane 1: MTRF1 transfected lysate(16.61 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MTRF1
Entrez GeneID
9617GeneBank Accession#
ENST00000239852Protein Accession#
ENSP00000239852Gene Name
MTRF1
Gene Alias
MGC47721, MRF1, MTTRF1, RF1
Gene Description
mitochondrial translational release factor 1
Omim ID
604601Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene was determined by in silico methods to be a mitochondrial protein with similarity to the peptide chain release factors (RFs) discovered in bacteria and yeast. The peptide chain release factors direct the termination of translation in response to the peptide chain termination codons. Initially thought to have a role in the termination of mitochondria protein synthesis, a recent publication found no mitochondrial translation release functionality. Multiple alternatively spliced transcript variants have been suggested by mRNA and EST data; however, their full-length natures are not clear. [provided by RefSeq
Other Designations
OTTHUMP00000018315|OTTHUMP00000018316|mitochontrial peptide chain release factor 1
-
Interactome
-
Publication Reference
-
Network Clustering Revealed the Systemic Alterations of Mitochondrial Protein Expression.
Jeon J, Jeong JH, Baek JH, Koo HJ, Park WH, Yang JS, Yu MH, Kim S, Pak YK.
PLoS Computational Biology 2011 Jun; 7(6):e1002093.
Application:WB-Ce, Human, 143B TK- osteosarcoma cells.
-
Network Clustering Revealed the Systemic Alterations of Mitochondrial Protein Expression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com