CREB5 monoclonal antibody (M02), clone 8A5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CREB5.
Immunogen
CREB5 (NP_001011666, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MFCTSGGNSASVMSMRPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKA
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (98); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CREB5 monoclonal antibody (M02), clone 8A5. Western Blot analysis of CREB5 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
CREB5 monoclonal antibody (M02), clone 8A5 Western Blot analysis of CREB5 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CREB5 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CREB5 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CREB5 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CREB5
Entrez GeneID
9586GeneBank Accession#
NM_001011666Protein Accession#
NP_001011666Gene Name
CREB5
Gene Alias
CRE-BPA
Gene Description
cAMP responsive element binding protein 5
Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the CRE (cAMP response element)-binding protein family. Members of this family contain zinc-finger and bZIP DNA-binding domains. The encoded protein specifically binds to CRE as a homodimer or a heterodimer with c-Jun or CRE-BP1, and functions as a CRE-dependent trans-activator. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
H_GS165L15.1|OTTHUMP00000122602|cAMP response element binding protein CRE-Bpa|cAMP response element-binding protein CRE-BPa|cAMP responsive element binding protein 5 isoform alpha
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
A trio of tumor suppressor miRNA downregulates CREB5 dependent transcription to modulate neoadjuvant hormonal therapy sensitivity.
Xueli Wang, Bo Han, Baokai Dou, Lin Gao, Feifei Sun, Mei Qi, Jing Zhang, Jing Hu.
Neoplasia 2023 Feb; 36:100875.
Application:IHC-P, Human, Human prostate cancers.
-
A trio of tumor suppressor miRNA downregulates CREB5 dependent transcription to modulate neoadjuvant hormonal therapy sensitivity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com