AKAP7 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human AKAP7 partial ORF ( NP_057461.1, 2 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
SEEFEANTMDSLVDMPFATVDIQDDCGITDEPQINLKRSQENEWVKSDQVKKRKKKRKDYQPNYFLSIPITNKEIIKGIKILQNAIIQQDERLAKAMVSDGSFHITLLVMQLLN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
38.28
Interspecies Antigen Sequence
Mouse (75)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — AKAP7
Entrez GeneID
9465GeneBank Accession#
NM_016377Protein Accession#
NP_057461.1Gene Name
AKAP7
Gene Alias
AKAP18
Gene Description
A kinase (PRKA) anchor protein 7
Omim ID
604693Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined. [provided by RefSeq
Other Designations
A-kinase anchor protein 7|A-kinase anchor protein 7 isoform alpha|A-kinase anchor protein 7, isoform alpha|A-kinase anchor protein 9 kDa|A-kinase anchor protein, 18-kD|A-kinase anchoring protein 18|OTTHUMP00000017200|OTTHUMP00000017201|OTTHUMP00000017202|
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com