NDST3 monoclonal antibody (M01), clone 5B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NDST3 monoclonal antibody (M01), clone 5B9 Western Blot analysis of NDST3 expression in Hela S3 NE ( Cat # L013V3 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NDST3 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NDST3.
Immunogen
NDST3 (NP_004775, 162 a.a. ~ 259 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IGFHKTSEKSVQSFQLKGFPFSIYGNLAVKDCCINPHSPLIRVTKSSKLEKGSLPGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (86)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NDST3 monoclonal antibody (M01), clone 5B9 Western Blot analysis of NDST3 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NDST3 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — NDST3
Entrez GeneID
9348GeneBank Accession#
NM_004784Protein Accession#
NP_004775Gene Name
NDST3
Gene Alias
HSST3, MGC130028, MGC130029
Gene Description
N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3
Omim ID
603950Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the heparan sulfate/heparin GlcNAc N-deacetylase/ N-sulfotransferase family. The encoded enzyme is a type II transmembrane protein that resides in the Golgi apparatus. This monomeric bifunctional enzyme catalyzes the N-deacetylation and N-sulfation of N-acetylglucosamine residues in heparan sulfate and heparin, which are the initial chemical modifications required for the biosynthesis of the functional oligosaccharide sequences that define the specific ligand binding activities of heparan sulfate and heparin. [provided by RefSeq
Other Designations
GlcNAc N-deacetylase/ N-sulfotransferase 3|OTTHUMP00000163903|bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3|glucosaminyl N-deacetylase/N-sulfotransferase 3
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com