SNAP29 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SNAP29 MaxPab rabbit polyclonal antibody. Western Blot analysis of SNAP29 expression in rat brain.
Western Blot (Transfected lysate)
Western Blot analysis of SNAP29 expression in transfected 293T cell line (H00009342-T02) by SNAP29 MaxPab polyclonal antibody.
Lane 1: SNAP29 transfected lysate(29.00 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human SNAP29 protein.
Immunogen
SNAP29 (NP_004773.1, 1 a.a. ~ 258 a.a) full-length human protein.
Sequence
MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL
Host
Rabbit
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (83); Rat (83)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SNAP29 MaxPab rabbit polyclonal antibody. Western Blot analysis of SNAP29 expression in rat brain.Western Blot (Transfected lysate)
Western Blot analysis of SNAP29 expression in transfected 293T cell line (H00009342-T02) by SNAP29 MaxPab polyclonal antibody.
Lane 1: SNAP29 transfected lysate(29.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SNAP29
Entrez GeneID
9342GeneBank Accession#
NM_004782.2Protein Accession#
NP_004773.1Gene Name
SNAP29
Gene Alias
CEDNIK, FLJ21051, SNAP-29
Gene Description
synaptosomal-associated protein, 29kDa
Gene Ontology
HyperlinkGene Summary
This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene. [provided by RefSeq
Other Designations
soluble 29 kDa NSF attachment protein|synaptosomal-associated protein 29|vesicle-membrane fusion protein SNAP-29
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com