TCEAL1 monoclonal antibody (M01), clone 3B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of TCEAL1 expression in transfected 293T cell line by TCEAL1 monoclonal antibody (M01), clone 3B9.
Lane 1: TCEAL1 transfected lysate(18.6 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of TCEAL1 transfected lysate using anti-TCEAL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TCEAL1 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TCEAL1 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (43.23 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant TCEAL1.
Immunogen
TCEAL1 (AAH00809, 1 a.a. ~ 159 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSEEEFFPEELLPELLPEMLLSEERPPQEGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWKAKRSRPYPI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81); Rat (78)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (43.23 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TCEAL1 expression in transfected 293T cell line by TCEAL1 monoclonal antibody (M01), clone 3B9.
Lane 1: TCEAL1 transfected lysate(18.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of TCEAL1 transfected lysate using anti-TCEAL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TCEAL1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TCEAL1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — TCEAL1
Entrez GeneID
9338GeneBank Accession#
BC000809Protein Accession#
AAH00809Gene Name
TCEAL1
Gene Alias
SIIR, p21, pp21
Gene Description
transcription elongation factor A (SII)-like 1
Omim ID
300237Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. The encoded protein is similar to transcription elongation factor A/transcription factor SII and contains a zinc finger-like motif as well as a sequence related to the transcription factor SII Pol II-binding region. It may exert its effects via protein-protein interactions with other transcriptional regulators rather than via direct binding of DNA. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq
Other Designations
OTTHUMP00000024293|OTTHUMP00000024294|OTTHUMP00000024295
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com