GTF3C3 monoclonal antibody (M02), clone 3D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GTF3C3 monoclonal antibody (M02), clone 3D9 Western Blot analysis of GTF3C3 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of GTF3C3 expression in transfected 293T cell line by GTF3C3 monoclonal antibody (M02), clone 3D9.
Lane 1: GTF3C3 transfected lysate(101.3 KDa).
Lane 2: Non-transfected lysate.
RNAi Knockdown (Antibody validated)
Western blot analysis of GTF3C3 over-expressed 293 cell line, cotransfected with GTF3C3 Validated Chimera RNAi ( Cat # H00009330-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with GTF3C3 monoclonal antibody (M02), clone 3D9 (Cat # H00009330-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (37.07 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GTF3C3.
Immunogen
GTF3C3 (NP_036218, 112 a.a. ~ 214 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TPEQPTAGDVFVLEMVLNRETKKMMKEKRPRSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.07 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GTF3C3 monoclonal antibody (M02), clone 3D9 Western Blot analysis of GTF3C3 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of GTF3C3 expression in transfected 293T cell line by GTF3C3 monoclonal antibody (M02), clone 3D9.
Lane 1: GTF3C3 transfected lysate(101.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of GTF3C3 over-expressed 293 cell line, cotransfected with GTF3C3 Validated Chimera RNAi ( Cat # H00009330-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with GTF3C3 monoclonal antibody (M02), clone 3D9 (Cat # H00009330-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — GTF3C3
Entrez GeneID
9330GeneBank Accession#
NM_012086Protein Accession#
NP_036218Gene Name
GTF3C3
Gene Alias
TFIIIC102, TFIIICgamma, TFiiiC2-102
Gene Description
general transcription factor IIIC, polypeptide 3, 102kDa
Omim ID
604888Gene Ontology
HyperlinkGene Summary
polypeptide 3
Other Designations
general transcription factor IIIC, polypeptide 3 (102kD)|transcription factor IIIC, 102 kD
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com