GPR56 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Flow Cytometry
FACS analysis of negative control 293 cells (Black) and GPR56 expressing 293 cells (Green) using GPR56 purified MaxPab mouse polyclonal antibody.
Western Blot (Tissue lysate)
GPR56 MaxPab polyclonal antibody. Western Blot analysis of GPR56 expression in human stomach.
Western Blot (Cell lysate)
GPR56 MaxPab polyclonal antibody. Western Blot analysis of GPR56 expression in IMR-32.
Western Blot (Transfected lysate)
Western Blot analysis of GPR56 expression in transfected 293T cell line (H00009289-T01) by GPR56 MaxPab polyclonal antibody.
Lane1:GPR56 transfected lysate(76.23 KDa).
Lane2:Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human GPR56 protein.
Immunogen
GPR56 (AAH08770.1, 1 a.a. ~ 693 a.a) full-length human protein.
Sequence
MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPASQQLQSLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGRSGEAEKRLLLVDFSSQALFQDKNSSHVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVTLQCVFWVEDPTLSSPGHWSSAGCETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHKHYLSLLSYVGCVVSALACLVTIAAYLCSRVPLPCRRKPRDYTIKVHMNLLLAVFLLDTSFLLSEPVALTGSEAGCRASAIFLHFSLLTCLSWMGLEGYNLYRLVVEVFGTYVPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPIILAVHRTPEGVIYPSMCWIRDSLVSYITNLGLFSLVFLFNMAMLATMVVQILRLRPHTQKWSHVLTLLGLSLVLGLPWALIFFSFASGTFQLVVLYLFSIITSFQGFLIFIWYWSMRLQARGGPSPLKSNSDSARLPISSGSTSSSRI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (78)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Flow Cytometry
FACS analysis of negative control 293 cells (Black) and GPR56 expressing 293 cells (Green) using GPR56 purified MaxPab mouse polyclonal antibody.Western Blot (Tissue lysate)
GPR56 MaxPab polyclonal antibody. Western Blot analysis of GPR56 expression in human stomach.Western Blot (Cell lysate)
GPR56 MaxPab polyclonal antibody. Western Blot analysis of GPR56 expression in IMR-32.Western Blot (Transfected lysate)
Western Blot analysis of GPR56 expression in transfected 293T cell line (H00009289-T01) by GPR56 MaxPab polyclonal antibody.
Lane1:GPR56 transfected lysate(76.23 KDa).
Lane2:Non-transfected lysate.
-
Gene Info — GPR56
Entrez GeneID
9289GeneBank Accession#
BC008770Protein Accession#
AAH08770.1Gene Name
GPR56
Gene Alias
BFPP, DKFZp781L1398, TM7LN4, TM7XN1
Gene Description
G protein-coupled receptor 56
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the G protein-coupled receptor family. The protein contains 7 transmembrane domains and a mucin-like domain in the N-terminal region. The gene is implicated in the regulation of brain cortical patterning. The protein binds specifically to transglutaminase 2 in the extracellular space. Expression of this gene is downregulated in melanoma cell lines, and overexpression of this gene can suppress tumor growth and metastasis. Mutations in this gene result in bilateral frontoparietal polymicrogyria. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
EGF-TM7-like|seven transmembrane helix receptor
-
Interactome
-
Disease
-
Publication Reference
-
Anti-GPR56 monoclonal antibody potentiates GPR56-mediated Src-Fak signaling to modulate cell adhesion.
Treena Chatterjee, Sheng Zhang, Tressie A Posey, Joan Jacob, Ling Wu, Wangsheng Yu, Liezl E Francisco, Qingyun J Liu, Kendra S Carmon.
The Journal of Biological Chemistry 2021 Jan; 296:100261.
Application：WB, Human, 293T cells.
-
Anti-GPR56 monoclonal antibody potentiates GPR56-mediated Src-Fak signaling to modulate cell adhesion.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com