RGN monoclonal antibody (M04), clone 4B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RGN expression in transfected 293T cell line by RGN monoclonal antibody (M04), clone 4B9.
Lane 1: RGN transfected lysate(33.3 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RGN is 3 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to RGN on HeLa cell . [antibody concentration 15 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RGN.
Immunogen
RGN (NP_004674.1, 200 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (88)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RGN expression in transfected 293T cell line by RGN monoclonal antibody (M04), clone 4B9.
Lane 1: RGN transfected lysate(33.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RGN is 3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RGN on HeLa cell . [antibody concentration 15 ug/ml] -
Gene Info — RGN
Entrez GeneID
9104GeneBank Accession#
NM_004683Protein Accession#
NP_004674.1Gene Name
RGN
Gene Alias
RC, SMP30
Gene Description
regucalcin (senescence marker protein-30)
Omim ID
300212Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23. Alternative splicing results in two transcript variants having different 5' UTRs, but encoding the same protein. [provided by RefSeq
Other Designations
OTTHUMP00000023195|OTTHUMP00000023196|regucalcin|senescence marker protein-30
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com