CD84 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CD84 MaxPab polyclonal antibody. Western Blot analysis of CD84 expression in human spleen.
Western Blot (Transfected lysate)
Western Blot analysis of CD84 expression in transfected 293T cell line (H00008832-T01) by CD84 MaxPab polyclonal antibody.
Lane 1: CD84 transfected lysate(36.08 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CD84 protein.
Immunogen
CD84 (NP_003865.1, 1 a.a. ~ 328 a.a) full-length human protein.
Sequence
MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQDAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (57); Rat (54)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CD84 MaxPab polyclonal antibody. Western Blot analysis of CD84 expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of CD84 expression in transfected 293T cell line (H00008832-T01) by CD84 MaxPab polyclonal antibody.
Lane 1: CD84 transfected lysate(36.08 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CD84
Entrez GeneID
8832GeneBank Accession#
NM_003874.1Protein Accession#
NP_003865.1Gene Name
CD84
Gene Alias
DKFZp781E2378, LY9B, SLAMF5, hCD84, mCD84
Gene Description
CD84 molecule
Omim ID
604513Gene Ontology
HyperlinkGene Summary
Members of the CD2 (see MIM 186990) subgroup of the Ig superfamily, such as CD84, have similar patterns of conserved disulfide bonds and function in adhesion interactions between T lymphocytes and accessory cells.[supplied by OMIM
Other Designations
CD84 antigen (leukocyte antigen)|OTTHUMP00000024394|leucocyte differentiation antigen CD84|leukocyte antigen CD84|leukocyte differentiation antigen CD84
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com