CES2 monoclonal antibody (M02), clone 4F12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CES2.
Immunogen
CES2 (NP_003860, 514 a.a. ~ 621 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERHT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (72); Rat (73)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CES2 monoclonal antibody (M02), clone 4F12 Western Blot analysis of CES2 expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CES2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CES2 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — CES2
Entrez GeneID
8824GeneBank Accession#
NM_003869Protein Accession#
NP_003860Gene Name
CES2
Gene Alias
CE-2, CES2A1, PCE-2, iCE
Gene Description
carboxylesterase 2 (intestine, liver)
Omim ID
605278Gene Ontology
HyperlinkGene Summary
Carboxylesterase 2 is a member of a large multigene family. The enzymes encoded by these genes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined; however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
carboxylesterase 2|intestinal carboxylesterase; liver carboxylesterase-2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Clinical implications of CES2 RNA expression in neuroblastoma.
Uchida K, Otake K, Tanaka K, Hashimoto K, Saigusa S, Matsushita K, Koike Y, Inoue M, Ueeda M, Okugawa Y, Inoue Y, Mohri Y, Kusunoki M.
Journal of Pediatric Surgery 2013 Mar; 48(3):502.
Application:WB, Human, Human neuroblastoma cell line KPN-SI(FA), INDEN.
-
Human Carboxylesterase-2 Hydrolyzes the Prodrug of Gemcitabine (LY2334737) and Confers Prodrug Sensitivity to Cancer Cells.
Pratt SE, Durland-Busbice S, Shepard RL, Heinz-Taheny K, Iversen PW, Dantzig AH.
Clinical Cancer Research 2013 Mar; 19(5):1159.
Application:IHC, Human, SK-OV-3 cells.
-
Clinical implications of CES2 RNA expression in neuroblastoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com