SNX4 monoclonal antibody (M01), clone 4H8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SNX4 monoclonal antibody (M01), clone 4H8 Western Blot analysis of SNX4 expression in A-431 ( Cat # L015V1 ).
Western Blot detection against Immunogen (37.73 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SNX4.
Immunogen
SNX4 (AAH18762, 341 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QCEELVTGTVRTFSLKGMTTKLFGQETPEQREARIKVLEEQINEGEQQLKSKNLEGREFVKNAWADIERFKEQKNRDLKEALISYAVMQISMCKKGIQVWTNAKECFSKM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SNX4 monoclonal antibody (M01), clone 4H8 Western Blot analysis of SNX4 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — SNX4
Entrez GeneID
8723GeneBank Accession#
BC018762Protein Accession#
AAH18762Gene Name
SNX4
Gene Alias
-
Gene Description
sorting nexin 4
Omim ID
605931Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein associated with the long isoform of the leptin receptor and with receptor tyrosine kinases for platelet-derived growth factor, insulin, and epidermal growth factor in cell cultures, but its function is unknown. This protein may form oligomeric complexes with family members. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
-
Publication Reference
-
SNX4 coordinates endosomal sorting of TfnR with dynein-mediated transport into the endocytic recycling compartment.
Traer CJ, Rutherford AC, Palmer KJ, Wassmer T, Oakley J, Attar N, Carlton JG, Kremerskothen J, Stephens DJ, Cullen PJ.
Nature Cell Biology 2007 Nov; 9(12):1370.
Application：WB-Tr, Human, HeLa cells.
-
SNX4 coordinates endosomal sorting of TfnR with dynein-mediated transport into the endocytic recycling compartment.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com