B4GALT4 monoclonal antibody (M01), clone 5E2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant B4GALT4.
Immunogen
B4GALT4 (NP_003769, 35 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNRE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (77); Rat (75)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of B4GALT4 expression in transfected 293T cell line by B4GALT4 monoclonal antibody (M01), clone 5E2.
Lane 1: B4GALT4 transfected lysate(40 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged B4GALT4 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of B4GALT4 over-expressed 293 cell line, cotransfected with B4GALT4 Validated Chimera RNAi ( Cat # H00008702-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with B4GALT4 monoclonal antibody (M01), clone 5E2 (Cat # H00008702-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — B4GALT4
Entrez GeneID
8702GeneBank Accession#
NM_003778Protein Accession#
NP_003769Gene Name
B4GALT4
Gene Alias
B4Gal-T4, beta4Gal-T4
Gene Description
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
Omim ID
604015Gene Ontology
HyperlinkGene Summary
This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene appears to mainly play a role in glycolipid biosynthesis. Two alternatively spliced transcript variants have been found for this gene. [provided by RefSeq
Other Designations
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 4|beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 4
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com