RFXANK monoclonal antibody (M01), clone 4G10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RFXANK.
Immunogen
RFXANK (NP_003712.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPVNPEPDASVSSPQAGSSLKHSTTLTNRQRGNEVSALPATLD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (72); Rat (60)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RFXANK expression in transfected 293T cell line by RFXANK monoclonal antibody (M01), clone 4G10.
Lane 1: RFXANK transfected lysate (Predicted MW: 25.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RFXANK is approximately 3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RFXANK on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — RFXANK
Entrez GeneID
8625GeneBank Accession#
NM_003721Protein Accession#
NP_003712.1Gene Name
RFXANK
Gene Alias
ANKRA1, BLS, F14150_1, MGC138628, RFX-B
Gene Description
regulatory factor X-associated ankyrin-containing protein
Gene Ontology
HyperlinkGene Summary
Major histocompatibility (MHC) class II molecules are transmembrane proteins that have a central role in development and control of the immune system. The protein encoded by this gene, along with regulatory factor X-associated protein and regulatory factor-5, forms a complex that binds to the X box motif of certain MHC class II gene promoters and activates their transcription. Once bound to the promoter, this complex associates with the non-DNA-binding factor MHC class II transactivator, which controls the cell type specificity and inducibility of MHC class II gene expression. This protein contains ankyrin repeats involved in protein-protein interactions. Mutations in this gene have been linked to bare lymphocyte syndrome type II, complementation group B. Two transcript variants encoding different isoforms have been described for this gene, with only one isoform showing activation activity. [provided by RefSeq
Other Designations
DNA-binding protein RFXANK|RFX-Bdelta4|ankyrin repeat-containing regulatory factor X-associated protein|regulatory factor X subunit B
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com