DENR monoclonal antibody (M01), clone 1H3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DENR.
Immunogen
DENR (NP_003668, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGIS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (91)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.65 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DENR expression in transfected 293T cell line by DENR monoclonal antibody (M01), clone 1H3.
Lane 1: DENR transfected lysate(22.092 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of DENR over-expressed 293 cell line, cotransfected with DENR Validated Chimera RNAi ( Cat # H00008562-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DENR monoclonal antibody (M01), clone 1H3 (Cat # H00008562-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — DENR
Entrez GeneID
8562GeneBank Accession#
NM_003677Protein Accession#
NP_003668Gene Name
DENR
Gene Alias
DRP, DRP1, SMAP-3
Gene Description
density-regulated protein
Omim ID
604550Gene Ontology
HyperlinkGene Summary
This gene encodes a protein whose expression was found to increase in cultured cells at high density but not during growth arrest. This gene was also shown to have increased expression in cells overexpressing HER-2/neu proto-oncogene. The protein contains an SUI1 domain. In budding yeast, SUI1 is a translation initiation factor that along with eIF-2 and the initiator tRNA-Met, directs the ribosome to the proper translation start site. Proteins similar to SUI have been found in mammals, insects, and plants. [provided by RefSeq
Other Designations
smooth muscle cell associated protein-3
-
Interactome
-
Publication Reference
-
40S ribosome profiling reveals distinct roles for Tma20/Tma22 (MCT-1/DENR) and Tma64 (eIF2D) in 40S subunit recycling.
David J Young, Sezen Meydan, Nicholas R Guydosh.
Nature Communications 2021 May; 12(1):2976.
Application:WB-Tr, Yeast, Yeast cells.
-
40S ribosome profiling reveals distinct roles for Tma20/Tma22 (MCT-1/DENR) and Tma64 (eIF2D) in 40S subunit recycling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com