DDO monoclonal antibody (M09), clone 3F7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DDO expression in transfected 293T cell line by DDO monoclonal antibody (M09), clone 3F7.
Lane 1: DDO transfected lysate (Predicted MW: 41 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DDO is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DDO.
Immunogen
DDO (NP_003640, 270 a.a. ~ 369 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (80)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DDO expression in transfected 293T cell line by DDO monoclonal antibody (M09), clone 3F7.
Lane 1: DDO transfected lysate (Predicted MW: 41 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DDO is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — DDO
Entrez GeneID
8528GeneBank Accession#
NM_003649Protein Accession#
NP_003640Gene Name
DDO
Gene Alias
DASOX, DDO-1, DDO-2, FLJ45203
Gene Description
D-aspartate oxidase
Omim ID
124450Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a peroxisomal flavoprotein that catalyzes the oxidative deamination of D-aspartate and N-methyl D-aspartate. Flavin adenine dinucleotide or 6-hydroxyflavin adenine dinucleotide can serve as the cofactor in this reaction. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000017000|OTTHUMP00000017001|OTTHUMP00000017002|aspartic oxidase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com