SFRS17A monoclonal antibody (M02), clone 2G8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SFRS17A monoclonal antibody (M02), clone 2G8 Western Blot analysis of SFRS17A expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of SFRS17A expression in transfected 293T cell line by SFRS17A monoclonal antibody (M02), clone 2G8.
Lane 1: SFRS17A transfected lysate(51.5 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SFRS17A on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SFRS17A is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to SFRS17A on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.18 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RP13-297E16.1.
Immunogen
SFRS17A (NP_005079, 53 a.a. ~ 156 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPC
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.18 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SFRS17A monoclonal antibody (M02), clone 2G8 Western Blot analysis of SFRS17A expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of SFRS17A expression in transfected 293T cell line by SFRS17A monoclonal antibody (M02), clone 2G8.
Lane 1: SFRS17A transfected lysate(51.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SFRS17A on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SFRS17A is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SFRS17A on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SFRS17A
Entrez GeneID
8227GeneBank Accession#
NM_005088Protein Accession#
NP_005079Gene Name
SFRS17A
Gene Alias
721P, CCDC133, CXYorf3, DXYS155E, MGC125365, MGC125366, MGC39904, XE7, XE7Y
Gene Description
splicing factor, arginine/serine-rich 17A
Gene Ontology
HyperlinkGene Summary
O
Other Designations
B-lymphocyte surface antigen|DNA segment on chromosome X and Y (unique) 155 expressed sequence|OTTHUMP00000022833|pseudoautosomal gene XE7
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com