NCOA4 monoclonal antibody (M04), clone 1B7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NCOA4.
Immunogen
NCOA4 (NP_005428, 505 a.a. ~ 614 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (82); Rat (81)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NCOA4 monoclonal antibody (M04), clone 1B7 Western Blot analysis of NCOA4 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NCOA4 is approximately 3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to NCOA4 on NIH/3T3 cell. [antibody concentration 10 ug/ml] -
Gene Info — NCOA4
Entrez GeneID
8031GeneBank Accession#
NM_005437Protein Accession#
NP_005428Gene Name
NCOA4
Gene Alias
ARA70, DKFZp762E1112, ELE1, PTC3, RFG
Gene Description
nuclear receptor coactivator 4
Gene Ontology
HyperlinkGene Summary
This gene encodes an androgen receptor coactivator. The encoded protein interacts with the androgen receptor in a ligand-dependent manner to enhance its transcriptional activity. Chromosomal translocations between this gene and the ret tyrosine kinase gene, also located on chromosome 10, have been associated with papillary thyroid carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes are present on chromosomes 4, 5, 10, and 14. [provided by RefSeq
Other Designations
ELE1/ret TK|OTTHUMP00000019601|OTTHUMP00000019603|RET-activating gene ELE1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Molecular constitution of breast but not other reproductive tissues is rich in growth promoting molecules: A possible link to highest incidence of tumor growths.
Poola I, Abraham J, Marshalleck JJ, Yue Q, Fu SW, Viswanath L, Sharma N, Hill R, Dewitty RL, Bonney G.
FEBS Letters 2009 Sep; 583(18):3069.
Application:IHC-P, Human, Breast, Overy, Uterus.
-
Molecular constitution of breast but not other reproductive tissues is rich in growth promoting molecules: A possible link to highest incidence of tumor growths.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com