SF1 monoclonal antibody (M01A), clone 2E12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SF1.
Immunogen
SF1 (NP_004621, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERH
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SF1 expression in transfected 293T cell line by SF1 monoclonal antibody (M01A), clone 2E12.
Lane 1: SF1 transfected lysate (Predicted MW: 59.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — SF1
-
Interactome
-
Publication Reference
-
FUBP1 is a general splicing factor facilitating 3' splice site recognition and splicing of long introns.
Stefanie Ebersberger, Clara Hipp, Miriam M Mulorz, Andreas Buchbender, Dalmira Hubrich, Hyun-Seo Kang, Santiago Martínez-Lumbreras, Panajot Kristofori, F X Reymond Sutandy, Lidia Llacsahuanga Allcca, Jonas Schönfeld, Cem Bakisoglu, Anke Busch, Heike Hänel, Kerstin Tretow, Mareen Welzel, Antonella Di Liddo, Martin M Möckel, Kathi Zarnack, Ingo Ebersberger, Stefan Legewie, Katja Luck, Michael Sattler, Julian König.
Molecular Cell 2023 Aug; 83(15):2653.
Application:RIP-A, Human, HeLa cell.
-
Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
Crisci A, Raleff F, Bagdiul I, Raabe M, Urlaub H, Rain JC, Kramer A.
Nucleic Acids Research 2015 Dec; 43(21):10456.
Application:IP, WB, Human, HeLa cells.
-
FUBP1 is a general splicing factor facilitating 3' splice site recognition and splicing of long introns.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com