USF2 monoclonal antibody (M02), clone 5F2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant USF2.
Immunogen
USF2 (NP_003358, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGGQVTYRVVQVTDGQLDGQGDTAGAVS
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
USF2 monoclonal antibody (M02), clone 5F2. Western Blot analysis of USF2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
USF2 monoclonal antibody (M02), clone 5F2. Western Blot analysis of USF2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
USF2 monoclonal antibody (M02), clone 5F2. Western Blot analysis of USF2 expression in different cell lines.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to USF2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged USF2 is approximately 10ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to USF2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — USF2
Entrez GeneID
7392GeneBank Accession#
NM_003367Protein Accession#
NP_003358Gene Name
USF2
Gene Alias
FIP, bHLHb12
Gene Description
upstream transcription factor 2, c-fos interacting
Omim ID
600390Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
c-fos interacting protein|upstream stimulatory factor 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com