UGP2 monoclonal antibody (M01), clone 3H3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant UGP2.
Immunogen
UGP2 (NP_001001521, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNI
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
UGP2 monoclonal antibody (M01), clone 3H3. Western Blot analysis of UGP2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
UGP2 monoclonal antibody (M01), clone 3H3. Western Blot analysis of UGP2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
UGP2 monoclonal antibody (M01), clone 3H3 Western Blot analysis of UGP2 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
UGP2 monoclonal antibody (M01), clone 3H3. Western Blot analysis of UGP2 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Transfected lysate)
Western Blot analysis of UGP2 expression in transfected 293T cell line by UGP2 monoclonal antibody (M01), clone 3H3.
Lane 1: UGP2 transfected lysate(56.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UGP2 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of UGP2 over-expressed 293 cell line, cotransfected with UGP2 Validated Chimera RNAi ( Cat # H00007360-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with UGP2 monoclonal antibody (M01), clone 3H3 (Cat # H00007360-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — UGP2
Entrez GeneID
7360GeneBank Accession#
NM_001001521Protein Accession#
NP_001001521Gene Name
UGP2
Gene Alias
UDPG, UDPGP2, UGPP2, pHC379
Gene Description
UDP-glucose pyrophosphorylase 2
Omim ID
191760Gene Ontology
HyperlinkGene Summary
The enzyme encoded by this gene is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
UDP-glucose diphosphorylase|UGPase 2|UTP--glucose-1-phosphate uridylyltransferase 2|UTP-glucose-1-phosphate uridyltransferase|uridyl diphosphate glucose pyrophosphorylase 2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com