TSTA3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of TSTA3 expression in transfected 293T cell line (H00007264-T01) by TSTA3 MaxPab polyclonal antibody.
Lane 1: TSTA3 transfected lysate(35.31 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human TSTA3 protein.
Immunogen
TSTA3 (NP_003304.1, 1 a.a. ~ 321 a.a) full-length human protein.
Sequence
MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TSTA3 expression in transfected 293T cell line (H00007264-T01) by TSTA3 MaxPab polyclonal antibody.
Lane 1: TSTA3 transfected lysate(35.31 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TSTA3
Entrez GeneID
7264GeneBank Accession#
NM_003313.2Protein Accession#
NP_003304.1Gene Name
TSTA3
Gene Alias
FX, P35B, SDR4E1
Gene Description
tissue specific transplantation antigen P35B
Omim ID
137020Gene Ontology
HyperlinkGene Summary
Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II. [provided by RefSeq
Other Designations
3-5 epimerase/4-reductase|GDP-4-keto-6-deoxy-D-mannose epimerase-reductase|Tissue-specific transplantation antigen-3|short chain dehydrogenase/reductase family 4E, member 1|tissue specific transplantation antigen 3
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com