TPT1 monoclonal antibody (M06), clone 2A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TPT1.
Immunogen
TPT1 (AAH22436, 35 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.18 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TPT1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of TPT1 expression in PC-12.Western Blot (Cell lysate)
TPT1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of TPT1 expression in NIH/3T3.Western Blot (Cell lysate)
TPT1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of TPT1 expression in IMR-32.Western Blot (Cell lysate)
TPT1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of TPT1 expression in Raw 264.7.Western Blot (Recombinant protein)
ELISA
-
Gene Info — TPT1
Entrez GeneID
7178GeneBank Accession#
BC022436Protein Accession#
AAH22436Gene Name
TPT1
Gene Alias
FLJ27337, HRF, TCTP, p02
Gene Description
tumor protein, translationally-controlled 1
Omim ID
600763Gene Ontology
HyperlinkGene Summary
O
Other Designations
OTTHUMP00000018344|fortilin|histamine-releasing factor
-
Interactome
-
Disease
-
Publication Reference
-
Methomyl induced effect on fortilin and S100A1 in serum and cardiac tissue: Potential biomarkers of toxicity.
Nusair SD, Joukhan AN, Rashaid AB, Rababa'h AM.
Human & Experimental Toxicology 2018 Nov; 960327118814153.
Application:Det Ab, Rat, Rat serum.
-
Histamine-releasing factor enhances food allergy.
Ando T, Kashiwakura JI, Itoh-Nagato N, Yamashita H, Baba M, Kawakami Y, Tsai SH, Inagaki N, Takeda K, Iwata T, Shimojo N, Fujisawa T, Nagao M, Matsumoto K, Kawakami Y, Kawakami T.
The Journal of Clinical Investigation 2017 Nov; [Epub].
Application:ELISA, Mouse, Mouse mast cells.
-
Elevation of serum fortilin levels is specific for apoptosis and signifies cell death in vivo.
Sinthujaroen P, Wanachottrakul N, Pinkaew D, Petersen JR, Phongdara A, Sheffield-Moore M, Fujise K.
BBA Clinical 2014 Dec; 2:103.
Application:ELISA, Human, Mouse, Serum.
-
Methomyl induced effect on fortilin and S100A1 in serum and cardiac tissue: Potential biomarkers of toxicity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com