STCH monoclonal antibody (M02), clone 1H8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
STCH monoclonal antibody (M02), clone 1H8. Western Blot analysis of STCH expression in NIH/3T3 ( Cat # L018V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STCH is approximately 1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to HSPA13 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.3 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STCH.
Immunogen
STCH (NP_008879.3, 375 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDPDLAVVTGVAIQAGIDGGSWPLQVSALEIPNKHLQKTNF
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.3 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
STCH monoclonal antibody (M02), clone 1H8. Western Blot analysis of STCH expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STCH is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to HSPA13 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — HSPA13
Entrez GeneID
6782GeneBank Accession#
NM_006948Protein Accession#
NP_008879.3Gene Name
HSPA13
Gene Alias
STCH
Gene Description
heat shock protein 70kDa family, member 13
Omim ID
601100Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the heat shock protein 70 family and is found associated with microsomes. Members of this protein family play a role in the processing of cytosolic and secretory proteins, as well as in the removal of denatured or incorrectly-folded proteins. The encoded protein contains an ATPase domain and has been shown to associate with a ubiquitin-like protein. [provided by RefSeq
Other Designations
heat shock protein 70kDa family member 13|microsomal stress 70 protein ATPase core|stress 70 protein chaperone, microsome-associated, 60kD|stress 70 protein chaperone, microsome-associated, 60kDa
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com