SP3 monoclonal antibody (M16), clone 3F2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SP3.
Immunogen
SP3 (NP_003102, 287 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TAGINADGHLINTGQAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSSSQLPVTIDSTGILQQNTNSLTTSSGQVHSSDLQGNYIQSPVSEETQAQNIQVSTAQPVVQHLQLQESQQPTSQAQIVQGITPQTIHGVQASGQN*
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.95 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SP3 monoclonal antibody (M16), clone 3F2. Western Blot analysis of SP3 expression in human colon.Western Blot (Recombinant protein)
ELISA
-
Gene Info — SP3
Entrez GeneID
6670GeneBank Accession#
NM_003111Protein Accession#
NP_003102Gene Name
SP3
Gene Alias
DKFZp686O1631, SPR-2
Gene Description
Sp3 transcription factor
Omim ID
601804Gene Ontology
HyperlinkGene Summary
This gene belongs to a family of Sp1 related genes that encode transcription factors that regulate transcription by binding to consensus GC- and GT-box regulatory elements in target genes. This protein contains a zinc finger DNA-binding domain and several transactivation domains, and has been reported to function as a bifunctional transcription factor that either stimulates or represses the transcription of numerous genes. Transcript variants encoding different isoforms have been described for this gene, and one has been reported to initiate translation from a non-AUG (AUA) start codon. Additional isoforms, resulting from the use of alternate downstream translation initiation sites, have also been noted. [provided by RefSeq
Other Designations
GC-binding transcription factor Sp3|specificity protein 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com