SORD monoclonal antibody (M01), clone 4D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SORD.
Immunogen
SORD (NP_003095, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGR
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SORD monoclonal antibody (M01), clone 4D3 Western Blot analysis of SORD expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
SORD monoclonal antibody (M01), clone 4D3. Western Blot analysis of SORD expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
SORD monoclonal antibody (M01), clone 4D3. Western Blot analysis of SORD expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
SORD monoclonal antibody (M01), clone 4D3. Western Blot analysis of SORD expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Transfected lysate)
Western Blot analysis of SORD expression in transfected 293T cell line by SORD monoclonal antibody (M01), clone 4D3.
Lane 1: SORD transfected lysate(38.165 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SORD on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.2 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SORD is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — SORD
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Sorbitol dehydrogenase expression is regulated by androgens in the human prostate.
Szabo Z, Hamalainen J, Loikkanen I, Moilanen AM, Hirvikoski P, Vaisanen T, Paavonen TK, Vaarala MH.
Oncology Reports 2010 May; 23(5):1233.
Application:IHC-P, WB-Re, WB-Ti, Human, Human prostates.
-
Sorbitol dehydrogenase expression is regulated by androgens in the human prostate.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com