SOD3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Human SOD3 partial ORF ( AAH14418, 26 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
EPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGTLHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGC
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.41
Interspecies Antigen Sequence
Mouse (62); Rat (57)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SOD3
Entrez GeneID
6649GeneBank Accession#
BC014418Protein Accession#
AAH14418Gene Name
SOD3
Gene Alias
EC-SOD, MGC20077
Gene Description
superoxide dismutase 3, extracellular
Omim ID
185490Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the superoxide dismutase (SOD) protein family. SODs are antioxidant enzymes that catalyze the dismutation of two superoxide radicals into hydrogen peroxide and oxygen. The product of this gene is thought to protect the brain, lungs, and other tissues from oxidative stress. The protein is secreted into the extracellular space and forms a glycosylated homotetramer that is anchored to the extracellular matrix (ECM) and cell surfaces through an interaction with heparan sulfate proteoglycan and collagen. A fraction of the protein is cleaved near the C-terminus before secretion to generate circulating tetramers that do not interact with the ECM. [provided by RefSeq
Other Designations
OTTHUMP00000158715
-
Interactomes
-
Diseases
-
Publication Reference
-
Extracellular Superoxide Dismutase Deficiency Impairs Wound Healing in Advanced Age by Reducing Neovascularization and Fibroblast Function.
Fujiwara T, Duscher D, Rustad KC, Kosaraju R, Rodrigues M, Whittam AJ, Januszyk M, Maan ZN, Gurtner GC.
Experimental Dermatology 2016 Mar; 25(3):206.
Application：Proliferation assay, Mouse, Fibroblasts.
-
Extracellular Superoxide Dismutase Deficiency Impairs Wound Healing in Advanced Age by Reducing Neovascularization and Fibroblast Function.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com