SLC11A1 monoclonal antibody (M01), clone 2G2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SLC11A1.
Immunogen
SLC11A1 (NP_000569.2, 308 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGV
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (30.47 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SLC11A1 monoclonal antibody (M01), clone 2G2. Western Blot analysis of SLC11A1 expression in human liver.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLC11A1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — SLC11A1
Entrez GeneID
6556GeneBank Accession#
NM_000578Protein Accession#
NP_000569.2Gene Name
SLC11A1
Gene Alias
LSH, NRAMP, NRAMP1
Gene Description
solute carrier family 11 (proton-coupled divalent metal ion transporters), member 1
Gene Ontology
HyperlinkGene Summary
This gene is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as tuberculosis and leprosy, and inflammatory diseases such as rheumatoid arthritis and Crohn disease. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined. [provided by RefSeq
Other Designations
natural resistance-associated macrophage protein 1|solute carrier family 11 (sodium/phosphate symporters), member 1
-
Pathway
-
Disease
- Abortion
- Alzheimer disease
- Anemia
- Arthritis
- Asthma
- Atherosclerosis
- Autoimmune Diseases
- Behcet Syndrome
- Brucellosis
+ View More Disease
-
Publication Reference
-
Solute Carrier 11A1 Is Expressed by Innate Lymphocytes and Augments Their Activation.
Hedges JF, Kimmel E, Snyder DT, Jerome M, Jutila MA.
The Journal of Immunology 2013 Apr; 190(8):4263.
Application:IF, WB-Ce, Bovine, Human, γδ T , PBMCs, ELAM cells.
-
Solute Carrier 11A1 Is Expressed by Innate Lymphocytes and Augments Their Activation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com