SHC1 monoclonal antibody (M01), clone 3F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SHC1.
Immunogen
SHC1 (AAH33925, 171 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRELFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMAEQLRGEPWFHGKLS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (87)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SHC1 monoclonal antibody (M01), clone 3F4 Western Blot analysis of SHC1 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SHC1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SHC1 is approximately 0.03ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between PIK3R1 and SHC1. Huh7 cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-SHC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between PIK3R1 and SHC1. HeLa cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-SHC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between STAT5A and SHC1. Mahlavu cells were stained with anti-STAT5A rabbit purified polyclonal 1:1200 and anti-SHC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to SHC1 on A-431 cell. [antibody concentration 10 ug/ml] -
Gene Info — SHC1
Entrez GeneID
6464GeneBank Accession#
BC033925Protein Accession#
AAH33925Gene Name
SHC1
Gene Alias
FLJ26504, SHC, SHCA
Gene Description
SHC (Src homology 2 domain containing) transforming protein 1
Omim ID
600560Gene Ontology
HyperlinkOther Designations
OTTHUMP00000035409|OTTHUMP00000035471|SHC (Src homology 2 domain-containing) transforming protein 1|SHC-transforming protein 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Circular METRN RNA hsa_circ_0037251 Promotes Glioma Progression by Sponging miR-1229-3p and Regulating mTOR Expression.
Cao Q, Shi Y, Wang X, Yang J, Mi Y, Zhai G, Zhang M.
Scientific Reports 2019 Dec; 9(1):19791.
Application:WB-Tr, Human, U251, U373 cells.
-
Circular METRN RNA hsa_circ_0037251 Promotes Glioma Progression by Sponging miR-1229-3p and Regulating mTOR Expression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com