SFRS1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SFRS1 expression in transfected 293T cell line (H00006426-T01) by SFRS1 MaxPab polyclonal antibody.
Lane 1: SFRS1 transfected lysate(27.39 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SFRS1 protein.
Immunogen
SFRS1 (AAH10264, 1 a.a. ~ 248 a.a) full-length human protein.
Sequence
MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SFRS1 expression in transfected 293T cell line (H00006426-T01) by SFRS1 MaxPab polyclonal antibody.
Lane 1: SFRS1 transfected lysate(27.39 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SFRS1
Entrez GeneID
6426GeneBank Accession#
BC010264Protein Accession#
AAH10264Gene Name
SFRS1
Gene Alias
ASF, MGC5228, SF2, SF2p33, SRp30a
Gene Description
splicing factor, arginine/serine-rich 1
Omim ID
600812Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the arginine/serine-rich splicing factor protein family, and functions in both constitutive and alternative pre-mRNA splicing. The protein binds to pre-mRNA transcripts and components of the spliceosome, and can either activate or repress splicing depending on the location of the pre-mRNA binding site. The protein's ability to activate splicing is regulated by phosphorylation and interactions with other splicing factor associated proteins. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
pre-mRNA-splicing factor SF2, P33 subunit|splicing factor 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com