SARS monoclonal antibody (M01), clone 1H4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant SARS.
Immunogen
SARS (AAH00716, 1 a.a. ~ 514 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTLENRLQNMEVTDA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (95)
Isotype
IgG2a kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (82.28 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SARS monoclonal antibody (M01), clone 1H4 Western Blot analysis of SARS expression in Jurkat ( Cat # L017V1 ).Western Blot (Transfected lysate)
Western Blot analysis of SARS expression in transfected 293T cell line by SARS monoclonal antibody (M01), clone 1H4.
Lane 1: SARS transfected lysate(58.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SARS on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SARS is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of SARS over-expressed 293 cell line, cotransfected with SARS Validated Chimera RNAi ( Cat # H00006301-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SARS monoclonal antibody (M01), clone 1H4 (Cat # H00006301-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to SARS on HeLa cell. [antibody concentration 25 ug/ml] -
Gene Info — SARS
Entrez GeneID
6301GeneBank Accession#
BC000716Protein Accession#
AAH00716Gene Name
SARS
Gene Alias
FLJ36399, SERRS, SERS
Gene Description
seryl-tRNA synthetase
Omim ID
607529Gene Ontology
HyperlinkGene Summary
This gene belongs to the class II amino-acyl tRNA family. The encoded enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts. [provided by RefSeq
Other Designations
OTTHUMP00000013432|serine tRNA ligase 1, cytoplasmic|serine-tRNA ligase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Mutations of the aminoacyl-tRNA-synthetases SARS and WARS2 are implicated in the aetiology of autosomal recessive intellectual disability.
Musante L, Püttmann L, Kahrizi K, Garshasbi M, Hu H, Stehr H, Lipkowitz B, Otto S, Jensen LR, Tzschach A, Jamali P, Wienker T, Najmabadi H, Ropers HH, Kuss AW.
Human Mutation 2017 Mar; 38(6):621.
Application:IF, Human, HEK 293T cells.
-
Competitive binding between Seryl-tRNA synthetase/YY1 complex and NFKB1 at the distal segment results in differential regulation of human vegfa promoter activity during angiogenesis.
Fu CY, Wang PC, Tsai HJ.
Nucleic Acids Research 2017 Mar; 45(5):2423.
Application:ChIP, Human, HEK 293T cells.
-
tRNA synthetase counteracts c-Myc to develop functional vasculature.
Shi Y, Xu X, Zhang Q, Fu G, Mo Z, Wang GS, Kishi S, Yang XL.
ELife 2014 Jun; 3:e02349.
Application:IP, Human, HEK 293 cells.
-
miR-1 and miR-206 target different genes to have opposing roles during angiogenesis in zebrafish embryos.
Lin CY, Lee HC, Fu CY, Ding YY, Chen JS, Lee MH, Huang WJ, Tsai HJ.
Nature communications 2013 Nov; 4:2829.
Application:WB-Ti, WB-Tr, Zebrafish, Mouse, Embryo, C2C12 cells.
-
Mutations of the aminoacyl-tRNA-synthetases SARS and WARS2 are implicated in the aetiology of autosomal recessive intellectual disability.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com