RP2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
RP2 MaxPab polyclonal antibody. Western Blot analysis of RP2 expression in human pancreas.
Western Blot (Transfected lysate)
Western Blot analysis of RP2 expression in transfected 293T cell line (H00006102-T01) by RP2 MaxPab polyclonal antibody.
Lane 1: RP2 transfected lysate(38.5 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human RP2 protein.
Immunogen
RP2 (AAH43348.1, 1 a.a. ~ 350 a.a) full-length human protein.
Sequence
MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (89)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RP2 MaxPab polyclonal antibody. Western Blot analysis of RP2 expression in human pancreas.Western Blot (Transfected lysate)
Western Blot analysis of RP2 expression in transfected 293T cell line (H00006102-T01) by RP2 MaxPab polyclonal antibody.
Lane 1: RP2 transfected lysate(38.5 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — RP2
Entrez GeneID
6102GeneBank Accession#
BC043348.2Protein Accession#
AAH43348.1Gene Name
RP2
Gene Alias
DELXp11.3, KIAA0215, TBCCD2
Gene Description
retinitis pigmentosa 2 (X-linked recessive)
Gene Ontology
HyperlinkGene Summary
The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding. Progressive retinal degeneration may therefore be due to the accumulation of incorrectly-folded photoreceptor or neuron-specific tubulin isoforms followed by progressive cell death [provided by RefSeq
Other Designations
OTTHUMP00000023189|XRP2 protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com