ROM1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Flow Cytometry
FACS analysis of negative control 293 cells (Black) and ROM1 expressing 293 cells (Green) using ROM1 purified MaxPab mouse polyclonal antibody.
Western Blot (Tissue lysate)
ROM1 MaxPab polyclonal antibody. Western Blot analysis of ROM1 expression in human kidney.
Western Blot (Transfected lysate)
Western Blot analysis of ROM1 expression in transfected 293T cell line (H00006094-T01) by ROM1 MaxPab polyclonal antibody.
Lane1:ROM1 transfected lysate(38.61 KDa).
Lane2:Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ROM1 protein.
Immunogen
ROM1 (NP_000318.1, 1 a.a. ~ 351 a.a) full-length human protein.
Sequence
MAPVLPLVLPLQPRIRLAQGLWLLSWLLALAGGVILLCSGHLLVQLRHLGTFLAPSCQFPVLPQAALAAGAVALGTGLVGVGASRASLNAALYPPWRGVLGPLLVAGTAGGGGLLVVALGLALALPGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGTLGSMLAVTFLLQALVLLGLRYLQTALEGLGGVIDAGGETQGYLFPSGLKDMLKTAWLQGGVACRPAPEEAPPGEAPPKEDLSEA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (85)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Flow Cytometry
FACS analysis of negative control 293 cells (Black) and ROM1 expressing 293 cells (Green) using ROM1 purified MaxPab mouse polyclonal antibody.Western Blot (Tissue lysate)
ROM1 MaxPab polyclonal antibody. Western Blot analysis of ROM1 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of ROM1 expression in transfected 293T cell line (H00006094-T01) by ROM1 MaxPab polyclonal antibody.
Lane1:ROM1 transfected lysate(38.61 KDa).
Lane2:Non-transfected lysate.
-
Gene Info — ROM1
Entrez GeneID
6094GeneBank Accession#
NM_000327.2Protein Accession#
NP_000318.1Gene Name
ROM1
Gene Alias
ROM, ROSP1, TSPAN23
Gene Description
retinal outer segment membrane protein 1
Omim ID
180721Gene Ontology
HyperlinkGene Summary
This gene is a member of a photoreceptor-specific gene family and encodes an integral membrane protein found in the photoreceptor disk rim of the eye. This protein can form homodimers or can heterodimerize with another photoreceptor, retinal degeneration slow (RDS). It is essential for disk morphogenesis, and may also function as an adhesion molecule involved in the stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. Certain defects in this gene have been associated with the degenerative eye disease retinitis pigmentosa. [provided by RefSeq
Other Designations
rod outer segment membrane protein 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com