RGS3 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Human RGS3 full-length ORF ( AAH18072, 1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MLRGMYLTRNGNLQRRHTMKEAKDMKNKLGIFRRRSESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
46.86
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RGS3
Entrez GeneID
5998GeneBank Accession#
BC018072Protein Accession#
AAH18072Gene Name
RGS3
Gene Alias
C2PA, FLJ20370, FLJ31516, FLJ90496, PDZ-RGS3, RGP3
Gene Description
regulator of G-protein signaling 3
Omim ID
602189Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTP-ase activating protein which inhibits G-protein mediated signal transduction. The protein is largely cytosolic, but G-protein activation leads to translocation of this protein to the plasma membrane. A nuclear form of this protein has also been described, but its sequence has not been identified. Multiple alternatively spliced transcript variants have been described for this gene but the full-length nature of some transcripts is not yet known. [provided by RefSeq
Other Designations
OTTHUMP00000022813|OTTHUMP00000022814|OTTHUMP00000022815|regulator of G-protein signalling 3
-
Interactomes
-
Pathways
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com