RBBP6 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RBBP6 expression in transfected 293T cell line (H00005930-T01) by RBBP6 MaxPab polyclonal antibody.
Lane 1: RBBP6 transfected lysate(12.98 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to RBBP6 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human RBBP6 protein.
Immunogen
RBBP6 (NP_116015.2, 1 a.a. ~ 118 a.a) full-length human protein.
Sequence
MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAVCKNTISHFFYTLLLPL
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RBBP6 expression in transfected 293T cell line (H00005930-T01) by RBBP6 MaxPab polyclonal antibody.
Lane 1: RBBP6 transfected lysate(12.98 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to RBBP6 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RBBP6
Entrez GeneID
5930GeneBank Accession#
NM_032626Protein Accession#
NP_116015.2Gene Name
RBBP6
Gene Alias
DKFZp686P0638, DKFZp761B2423, MY038, P2P-R, PACT, RBQ-1, SNAMA
Gene Description
retinoblastoma binding protein 6
Omim ID
600938Gene Ontology
HyperlinkGene Summary
The retinoblastoma tumor suppressor (pRB) protein binds with many other proteins. In various human cancers, pRB suppresses cellular proliferation and is inactivated. Cell cycle-dependent phosphorylation regulates the activity of pRB. This gene encodes a protein which binds to underphosphorylated but not phosphorylated pRB. Multiple alternatively spliced transcript variants that encode different isoforms have been found for this gene. [provided by RefSeq
Other Designations
RB-binding Q-protein 1|proliferation potential-related protein|retinoblastoma-binding protein 6|retinoblastoma-binding protein 6, isoform 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com